PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC010696.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family bHLH
Protein Properties Length: 239aa    MW: 26907.7 Da    PI: 8.971
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC010696.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.11.8e-1473125155
                   CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
           HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                   ++ +hn+ Er RR+++N  +++Lr+llP a   + kKls  +++ +A +YI ++q
  EcC010696.40  73 KKLNHNASERDRRKKMNGLYSTLRSLLPAA--DRMKKLSVPTTVSRALKYIPEMQ 125
                   6789*************************6..49999**************9988 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088814.172124IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000833.09E-1473129No hitNo description
SuperFamilySSF474593.14E-1673142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.102.1E-1473142IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000107.3E-1273125IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003531.5E-1078130IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0055070Biological Processcopper ion homeostasis
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 239 aa     Download sequence    Send to blast
MLSFSPSGWP LEDSTSHEQW SHIHRDAYTC YSPPLLRFPF SSPPTLSPPA ELALDPLDIP  60
FGRAEGEEAT MVKKLNHNAS ERDRRKKMNG LYSTLRSLLP AADRMKKLSV PTTVSRALKY  120
IPEMQQQVEK LTQQKEKLLS RISASRDGDY YTSHQEISRG KGSLQILVPS ISTTRLSESE  180
VAIQISTGKV MTHKTVDFSE VLLALDYLGF PVISSTTFES CGGMKTTFYN LHVQVLYHR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010036348.11e-158PREDICTED: transcription factor ORG2-like
TrEMBLA0A059D2E51e-106A0A059D2E5_EUCGR; Uncharacterized protein
STRINGVIT_13s0047g00450.t011e-54(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.15e-44bHLH family protein